WDR9/BRWD1 (BD2), His-tag
Product Code
AMS.31115
Order Support
-
Email: [email protected]
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
SKU | AMS.31115 |
---|---|
Size | 100 ug |
Species | Human |
Expression Host | E. coli |
aa sequence | 1308-1436: MHHHHHHIRATNYVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEKLRRSQ |
Tag | His |
Application | Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. |
Accession No | NM_018963 |
Gene synonyms | bromodomain and WD repeat domain containing 1, BRWD1, WDR9, WD Repeat-Containing Protein 9 |
Storage | >6 months at -80C. |
Shipping Temp | Dry Ice |
Supplier Name | BPS |
Research Areas | Epigenetics |