RSPO1 (NM_001038633) Human Recombinant Protein

Product Code
TP723385
$315.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human R-spondin homolog (Xenopus laevis) (RSPO1).
More Information
SKU TP723385
Size 20 ug
Species Human
Expression Host CHO Cells
Gene symbol RSPO1
aa sequence SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Tag Untagged
Accession No NM_001038633
Gene id 284654
Gene synonyms CRISTIN3, RSPO
Protein Families Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 2 Weeks
For more details visit our R-spondin (RSPO1) page >