Histone H2a|Full Length|Biotin-labeled|His-tag Recombinant

Product Code
AMS.52036
$0.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Biotinylated Human Histone 2A|GenBank Accession No. NM_033445|a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa|expressed in an E. coli expression system.
More Information
SKU AMS.52036
Size 0.5 mg
Species Human
Expression Host E. coli
aa sequence 2-130(end) : MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC
Tag His
Tag position N-terminal
Label/Conjugate Biotin
Application Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Accession No NM_033445
Gene id NM_033445
Gene synonyms HIST1H2AI, H2A.1, histone H2A
Format Aqueous buffer solution
Storage At least 6 months at -80C.
Shipping Temp -80C (dry ice)
Supplier Name BPS
Research Areas Epigenetics
For more details visit our Histones and Nucleosomes page >For more details visit our Histone Methylation page >