VEGF165, Human (Sf9-derived)
Product Code
AMS.91001-2
Order Support
-
Email: [email protected]
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
SKU | AMS.91001-2 |
---|---|
Size | 100 ug |
Species | Human |
Expression Host | Insect Cells, Sf9 Cells |
aa sequence | 207-371: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Application | Useful for cell culture and for the study of signaling and developmental pathways. Also useful for receptor binding studies, screening inhibitors, and selectivity profiling. |
Accession No | NM_001025368 |
Gene synonyms | Vascular endothelial growth factor 165, VEGF |
Storage | >=2 years (lyophilized) at -20C. Reconstituted solutions can be stored in undiluted aliquots at 4C for; one week or at -20C for up to six months. |
Shipping Temp | Dry Ice |
Supplier Name | BPS |
Research Areas | Immunology |