VEGF165, Human (Sf9-derived)

Product Code
AMS.91001-1
$255.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

More Information
SKU AMS.91001-1
Size 10 ug
Species Human
Expression Host Insect Cells, Sf9 Cells
aa sequence 207-371: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Application Useful for cell culture and for the study of signaling and developmental pathways. Also useful for receptor binding studies, screening inhibitors, and selectivity profiling.
Accession No NM_001025368
Gene synonyms Vascular endothelial growth factor 165, VEGF
Storage >=2 years (lyophilized) at -20C. Reconstituted solutions can be stored in undiluted aliquots at 4C for; one week or at -20C for up to six months.
Shipping Temp Dry Ice
Supplier Name BPS
Research Areas Immunology
For more details visit our Cytokines and Growth Factors page >