VEGF165, Human (Sf9-derived)

Product Code
91001-2
$1,385.00
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Recombinant human VEGF165 (GenBank Accession No. NM_001025368) is a 38.2 kDa disulfide-linked homodimeric protein (a.a. 207-371), consisting of two 165 amino acid polypeptides.
More Information
SKU 91001-2
Size 100 ug
Alternate SKU AMS.91001-2
Species Human
Expression Host Insect Cells, Sf9 Cells
aa sequence 207-371: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Application Useful for cell culture and for the study of signaling and developmental pathways. Also useful for receptor binding studies, screening inhibitors, and selectivity profiling.
Accession No NM_001025368
Gene synonyms Vascular endothelial growth factor 165, VEGF
Format lyophilized protein
Storage >=2 years (lyophilized) at -20C. Reconstituted solutions can be stored in undiluted aliquots at 4C for; one week or at -20C for up to six months.
Shipping Temp -20C or -80C
Supplier Name BPS
Research Areas Immunology