TAF1 (BD2), His-tag

Product Code
AMS.31110
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

More Information
SKU AMS.31110
Size 100 ug
Species Human
Expression Host E. coli
aa sequence 1519 - 1651: MHHHHHHLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE
Tag His
Application Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Accession No NM_004606
Gene synonyms TAF1, TBP-associated factor
Storage >6 months at -80C.
Shipping Temp Dry Ice
Supplier Name BPS
Research Areas Epigenetics
For more details visit our Bromodomains page >