SMARCA2, His-tag
Product Code
AMS.31111
Order Support
-
Email: [email protected]
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
SKU | AMS.31111 |
---|---|
Size | 100 ug |
Species | Human |
Expression Host | E. coli |
aa sequence | 1375-1511: MHHHHHHKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE |
Tag | His |
Application | Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. |
Accession No | NM_003070 |
Gene synonyms | SMARCA2, BRM, BRG1-Associated Factor 190B, SWI/SNF Related, Matrix Associated, Actin Dependent Regulator Of Chromatin 2, BAF190, SNF2L2 |
Storage | >6 months at -80C. |
Shipping Temp | Dry Ice |
Supplier Name | BPS |
Research Areas | Epigenetics |