Histone H3|Full Length|Biotin-labeled|His-tag
Product Code
AMS.52053
$0.00
Order Support
-
Email: [email protected]
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Biotinylated Human Histone 3|GenBank Accession No. NM_003532|a.a. 2-136(end) with N-terminal Met-Ala-Cys-6xHis-tag (C97A|C111A). MW = 16.3 kDa|expressed in an E. coli expression system.
SKU | AMS.52053 |
---|---|
Size | 50 ug |
Species | Human |
Expression Host | E. coli |
aa sequence | 2-136(end): MACHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA |
Tag | His |
Tag position | N-terminal |
Label/Conjugate | Biotin |
Application | Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications. |
Accession No | NM_003532 |
Gene id | NM_003532 |
Gene synonyms | Histone 3.1, HIST1H3E |
Format | Aqueous buffer solution |
Storage | At least 6 months at -80C. |
Shipping Temp | -80C (dry ice) |
Supplier Name | BPS |
Research Areas | Epigenetics |