Histone H3|Full Length|Biotin-labeled|His-tag

Product Code
52047
$0.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Biotinylated Human Histone 3|GenBank Accession No. NM_003532|a.a. 2-136(end) with N-terminal Met-Ala-Cys-6xHis-tag (C97A|C111A). MW = 16.3 kDa|expressed in an E. coli expression system.
More Information
SKU 52047
Size 0.5 mg
Alternate SKU AMS.52047
Species Human
Expression Host E. coli
aa sequence 2-136(end): MACHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
Tag His
Tag position N-terminal
Label/Conjugate Biotin
Application Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Accession No NM_003532
Gene id NM_003532
Gene synonyms Histone 3.1, HIST1H3E
Format Aqueous buffer solution
Storage At least 6 months at -80C.
Shipping Temp -80C (dry ice)
Supplier Name BPS
Research Areas Epigenetics