Histone H2a|Full Length|Biotin-labeled|His-tag Recombinant
Product Code
52036
$0.00
Order Support
-
Email: [email protected]
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Biotinylated Human Histone 2A|GenBank Accession No. NM_033445|a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa|expressed in an E. coli expression system.
SKU | 52036 |
---|---|
Size | 0.5 mg |
Alternate SKU | AMS.52036 |
Species | Human |
Expression Host | E. coli |
aa sequence | 2-130(end) : MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC |
Tag | His |
Tag position | N-terminal |
Label/Conjugate | Biotin |
Application | Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications. |
Accession No | NM_033445 |
Gene id | NM_033445 |
Gene synonyms | HIST1H2AI, H2A.1, histone H2A |
Format | Aqueous buffer solution |
Storage | At least 6 months at -80C. |
Shipping Temp | -80C (dry ice) |
Supplier Name | BPS |
Research Areas | Epigenetics |