Histone H2a, Full Length, Biotin-labeled, His-tag

Product Code
52036
$545.00
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Biotinylated Human Histone 2A, GenBank Accession No. NM_033445, a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa, expressed in an E. coli expression system.
More Information
SKU 52036
Size 0.5 mg
Alternate SKU AMS.52036
Species Human
Expression Host E. coli
aa sequence 2-130(end) : MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC
Tag His
Tag position N-terminal
Label/Conjugate Biotin
Application Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Accession No NM_033445
Gene synonyms HIST1H2AI, H2A.1, histone H2A
Format Aqueous buffer solution
Storage >= 6 months at -80C
Shipping Temp -80C
Supplier Name BPS
Research Areas Epigenetics