Histone H1, Full Length, His-tag

Product Code
52042
$545.00
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Human Histone H1, also known as H1F0, (GenBank Accession No. NM_005318), a.a. 2-194(end) with N-terminal His-tag, MW = 21.7 kDa, expressed in an E. coli expression system.
More Information
SKU 52042
Size 1 mg
Alternate SKU AMS.52042
Species Human
Expression Host E. coli
aa sequence 2-194(end) : MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Tag His
Tag position N-terminal
Application Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Accession No NM_005318
Gene synonyms Histone H1, H1F0
Format Aqueous buffer solution
Storage >6 months at -80C.
Shipping Temp -80C
Supplier Name BPS
Research Areas Epigenetics