WDR9/BRWD1 (BD2), His-tag
Product Code
31115
$0.00
Order Support
-
Email: [email protected]
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, GenBank Accession No. NM_018963, a.a. 1308 - 1436 corresponding to bromodomain 2 with N-terminal His-tag, MW = 16.2 kDa, expressed in an E. coli expression system.
SKU | 31115 |
---|---|
Size | 100 ug |
Alternate SKU | AMS.31115 |
Species | Human |
Expression Host | E. coli |
aa sequence | 1308-1436: MHHHHHHIRATNYVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEKLRRSQ |
Tag | His |
Tag position | N-terminal |
Application | Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. |
Accession No | NM_018963 |
Gene id | NM_018963 |
Gene synonyms | bromodomain and WD repeat domain containing 1, BRWD1, WDR9, WD Repeat-Containing Protein 9 |
Format | Aqueous buffer solution |
Storage | >6 months at -80C. |
Shipping Temp | Dry Ice |
Supplier Name | BPS |
Research Areas | Epigenetics |